PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c4_6990V3.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 2593aa    MW: 278171 Da    PI: 5.7481
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c4_6990V3.3.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.48e-0912151258347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47  
                         WT  E el+ +av+++  + +++Ia+++g ++++ qcks++ k 
  Pp3c4_6990V3.3.p 1215 QWTDKERELFTEAVRLFRRD-FESIAAHVGSTKSEGQCKSFFSKT 1258
                        5*****************77.*********99*********9886 PP

2Myb_DNA-binding32.81.6e-1017091750346
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46  
                        +WT+eE e ++d ++ +G++ W++  ++++ +++l q+k ++q+
  Pp3c4_6990V3.3.p 1709 SWTQEEKEVFADIIRNHGKD-WTRLHECLP-TKSLTQIKTYFQN 1750
                        7*****************99.*********.************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.76E-139611024IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.0E-59681017IPR009057Homeodomain-like
PROSITE profilePS5129317.1799731024IPR017884SANT domain
SMARTSM007171.1E-79741022IPR001005SANT/Myb domain
PROSITE profilePS5129315.72712111263IPR017884SANT domain
SMARTSM007171.3E-712121261IPR001005SANT/Myb domain
PfamPF002491.3E-712151257IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-412151260IPR009057Homeodomain-like
SuperFamilySSF466891.58E-812151266IPR009057Homeodomain-like
CDDcd001672.78E-512161255No hitNo description
SuperFamilySSF466892.59E-1017041754IPR009057Homeodomain-like
PROSITE profilePS512938.25817051756IPR017884SANT domain
SMARTSM007173.8E-817061754IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.8E-717071751IPR009057Homeodomain-like
PfamPF002498.1E-817091750IPR001005SANT/Myb domain
CDDcd001677.57E-617091752No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 2593 aa     Download sequence    Send to blast
MYSPGRGDAR ATALPNARDS STSMPIDHSS AWQREPYNRD VRLDRGDRER TIGGKREWNS  60
DRASPGAPYQ RGFGGLHPVN GYLGPPSKRR LNGRHIGFHA GNGRYGSAGQ RGEPSFGSFV  120
PLENGLAPKF EQESFYLGSG RPVVNTGFSS GPGLDYRSKE LGERQRKGSF LTSGDGRDGG  180
SSGVNVQHVR LYPSQVLTEV ENTSWERERP KGQDGNGWES SQRSEREHRE RLLGKAESFS  240
RREGRFSQFE EGRERSQVDK DSDGSKLDRC GSSSWDRCSG DTMCGSKVSA NGFDWRRKER  300
STSVSASRNA SNGCSKESVV RPPVLDVSGS PSSPQLSLRS TPSALVEVSR DDGNHPSPAK  360
RPRLGWGQGL AKYEKKNEVV ETDDIFVSGS VDSASGSKRS SVTAVSGVKT EVVQMLGLQA  420
AEESSVSVIS KLSTLPLPKV SSSPLQKALE SVSKSSVESR AVEEVLGKAC EMVADEAVRS  480
SSNFTTPGVR AEDLVKTADV CALTECSLEL SVRQSYSWEP VEKPTAWKES NSCQASPTVP  540
CSVEQCCGVE VTQEVCSTGD TTWWSKEDIL QRVEKLESEI EQVERELSTS KRFGSLRNDT  600
HMPVPEIFEN SANADLGTKL EPGDYGPQVL ADNAVSSHAG SMECRDSSQL ILVSFPNRIC  660
SVSAECISHS VSSLETGAAV GAGPPMCNQA MGSKHRNMEN EVLVMEEWQS HEGEKEATSD  720
QTMVESEGEG SLVSSPSAEV YLPHMTLRER AGVEVRVSKS AIAKMESSDA AMVVGDVEAV  780
ARGLIGENKD QARHASEAFL HLLSQGGRGE GKVYSCPVEA PVWKENVERH VRNQEKMLEK  840
IAERRQSARF VEQVLTIKFR ALKDAWRQEQ FGTSQQQRGT KPVRRWEAEK RGGTAGCHRS  900
SLRLRPVQAG GGKLEAQSEE SMKRVMVEPV VGPLRPALKM PAMILGERER LARRFESNNA  960
LVEDPVRVES ERKSMNPWSA EERRVFLEKF AVYNKNFSKI ASHLEYKTTA DCVEFYCRNQ  1020
KSEDFEKIRR RQQLQKRRDC SRLGGSFLST GLQPNSRQRE ANIDARSEGW NMQTSGAVST  1080
VCQITVGAKA ARSSTHHKPL ERQRTSSSLD PGSLPAVVEI AKSTSGKESR PSGIPPLPSG  1140
AAGSGTTGSC SLSSATAASV KVSRERTSVK SNWNGGSAVA RSGTKEQQMS GPKGARSVNI  1200
RRGLTTSAGE ETDAQWTDKE RELFTEAVRL FRRDFESIAA HVGSTKSEGQ CKSFFSKTRK  1260
RLRLDQLVEK HQAALNFSAD AAVAESPECI DVQMEEVPGA AAEVVLVASL EANIYPSLGE  1320
EKVWNEATES GKVEEVANDV SIQATEAVEA EMCEDIAAEK TVEEESCEDV VVAKAVEEGL  1380
CEGVAIERAG KEEIFDNAAV HKAVEEVLSE DLLDEKAMED GSIEEKAGED GSIEEKAGED  1440
GSVEVKTVEN EGVVRKAVEH GAVKDVVVDD ETVDDVAEEG VVGVIEVVET VDFVGVSMDL  1500
TVESAVCPLE SPDIVENLEK AEADVGAGAC SMNECDTGEA EDVVAACIKA EPVVVDEGVV  1560
SEPLTVDAGE ELPAGNSSGS SADCGMQEEG DAVEVAKGAE SVVESVKREV DAGDDKGLGT  1620
VVATSILASE EQIVEASGAV DVKHQAGSPQ MAVSTGTESG SCAIGAEGAC HSGKAAYATT  1680
SSMHGSQQCR EKSGRVGSGE AKSRREPTSW TQEEKEVFAD IIRNHGKDWT RLHECLPTKS  1740
LTQIKTYFQN SKAKLGLVNS EGVSVGGGRG SGSRKRKAEE VDNMSNNVGC VNGRIESKCG  1800
SVSGGDVDGG GQKVKGGMGD PPSMSVSAGM GTIPVGLEGL AYPFFGQRVE DQMALHQFIR  1860
QLQLCNPNGF PQNIPPMLHP LLQQQGLGVF PDPGLQRAGP PNLQQQFAAS MSQKTSQSMG  1920
LQLALQGPGV GQQSGAVDLH QQGAHQLLNS QAARSQQQLL ANMMQQQAAA QLQQQQHPCS  1980
KSVVHSLQQA VLLQPGQVAQ RQQQQLMSPQ VVHHSQAHQA GGQHQQYQAL LQHQQFQQTV  2040
QHFQQQQDHV QAQALIHQHH SSHAPLPPSL VSSSKSIAVM PLPQHLSKIP LAPVLQQGIA  2100
VHEERNGAGV TSSRVNEGSA GSSHCEDASI QQVESGELRG SCSNGGPRGQ DFSRAEFHQL  2160
SGAVQRAPPS QTAVPLRPSP ISATESPQTR PGDVKLFGQS LLSQPTCSAG LQSAARAAPC  2220
ATDKVSLQQS PVHTMTLSST TGTSVPAATV SKVYGSETSF GGMSSMSDGR QSIWPSLGNL  2280
GSIETRNIAN GMHLQAGPLW KSKERESKLH NMQESRMFRE ARDAEPGQST PTNSYKLQPL  2340
EHSRNIQEHS RSEGFPSLNN PGFYLNEQGG GGGFSVSSVE ASRPELERRN ESSSIGSSGC  2400
ERGPSTCGRS SRGQMDSFAM KAAGLLANGP QVPRTMMNSL MAVADLHQSR SLLSGIGSPR  2460
LEDHQCGNFI RQAANGAAVD TLKADASVGL AGPLAAPQAH LSGGDLLQQC VRDSGMYFTQ  2520
HYSHLADHPG VSPGAWYAGT GLMHPSDVQR MLVNPALNPF LLGALSRAPS AAEEHLGSIE  2580
SRDPDNGGSG LR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C5e-159321026194NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D5e-159321026194NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.178760.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001771897.10.0predicted protein
TrEMBLA9SZT20.0A9SZT2_PHYPA; Predicted protein
STRINGPP1S143_55V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.12e-33MYB family protein